| Bioactivity | [Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50: 2.6 μM). [Pro3]-GIP (Mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (Mouse) can be used for research of type 2 diabetes[1][2]. |
| Name | [Pro3]-GIP (Mouse) |
| Sequence | Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Arg-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Shortening | YAPGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ |
| Formula | C225H342N62O64S |
| Molar Mass | 4971.62 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Irwin N, et al. Early administration of the glucose-dependent insulinotropic polypeptide receptor antagonist (Pro3)GIP prevents the development of diabetes and related metabolic abnormalities associated with genetically inherited obesity in ob/ob mice. Diabetologia. 2007 Jul;50(7):1532-40. [2]. Gault VA, et al. Characterization of the cellular and metabolic effects of a novel enzyme-resistant antagonist of glucose-dependent insulinotropic polypeptide. Biochem Biophys Res Commun. 2002 Feb 8;290(5):1420-6. |